DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccndx

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001165869.1 Gene:ccndx / 567411 ZFINID:ZDB-GENE-080917-47 Length:297 Species:Danio rerio


Alignment Length:226 Identity:47/226 - (20%)
Similarity:80/226 - (35%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 RAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQ----------------VVKDTKRTYLQLVGV 338
            |..|..|..||..:.......|.|||:::||||.                ::..:|.|....|..
Zfish    62 REELAKWTMEVCCECDCDESVFPLAVSLLDRYLSATLSLPVSPSCLAAACILLASKVTESDTVSA 126

  Fly   339 TALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAG 403
            ..|..|.:|:                 :.:..:|:||..:...:..::....|..|:..:.:..|
Zfish   127 DTLCAAAEYD-----------------FLSANLREMERVVLATLRWDV
LAVTPQDFIPLFLRTLG 174

  Fly   404 --AEDEHH------TMSKY---FIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFND 457
              .:.:.|      ||.::   .:.:...|.......||.:|||:|..:|..|    ||.:....
Zfish   175 ELRDGDGHTGDFLTTMRRHGDTLVAMCVCDSRFLGTPPSLVAAAALNSALRGL----RARSAGEM 235

  Fly   458 RHWTPTLTFYSRYSAAHLRPITRLIAKLARD 488
            ...|..|....:...|.|:..|.||....|:
Zfish   236 SLMTAALATLCQTDVALLQCCTELIDGALRE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 22/112 (20%)
Cyclin_C 389..515 CDD:281044 25/111 (23%)
ccndxNP_001165869.1 Cyclin_N 34..157 CDD:278560 22/111 (20%)
Cyclin_C 160..>260 CDD:281044 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.