DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccnd2b

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_005164578.1 Gene:ccnd2b / 565038 ZFINID:ZDB-GENE-050420-354 Length:330 Species:Danio rerio


Alignment Length:159 Identity:49/159 - (30%)
Similarity:80/159 - (50%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            ||::...||.::..|:.||..:.....:.|.||:..:||:|..| .|::.||||:|...||:|:|
Zfish    82 QKDIQPFMRKMVATWMLEVCEEEKCEDDVFPLAMNYLDRFLAAV-PTRKCYLQLLGAVCLFLASK 145

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRR-YSKAAGAED---- 406
            .:...|.:.......||::.|::|:.:.||.:...:..||:...|:.|:.. ..|....||    
Zfish   146 LKACQPLSARKLCMYTDNSITSQQLLEWELVVLSKLKWNLA
AITPLDFIEHILHKLPFHEDRLTL 210

  Fly   407 -EHHTMSKYFIELASVDYEMATYRPSEIA 434
             ..||.:  ||.|.:.|:....|.||.||
Zfish   211 IRKHTQT--FIALCATDHSFTMYPPSMIA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 32/104 (31%)
Cyclin_C 389..515 CDD:281044 16/52 (31%)
ccnd2bXP_005164578.1 Cyclin_N 60..186 CDD:278560 32/104 (31%)
Cyclin_C 189..>291 CDD:281044 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.