DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccnj

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_021336586.1 Gene:ccnj / 557593 ZFINID:ZDB-GENE-100721-4 Length:355 Species:Danio rerio


Alignment Length:274 Identity:68/274 - (24%)
Similarity:102/274 - (37%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EYVNDIYDYLYQVELEQPIHKDHLAGQK-EVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIID 319
            |...|||..|...||..|.:|    ||. ::|  :|....|.|..|..:|.|......|||.::|
Zfish    11 ELAEDIYQALRYKELRLPAYK----GQSPQLS--LRRYFADLIAIVSNRFKLCPAARHLAVYLLD 69

  Fly   320 RYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDD-------------------T 365
            .::... |.....|.:|.::.|.:|:|:||            .:|                   .
Zfish    70 LFMDRY-DISVQQLHMVALSCLLLASKFEE------------REDRVPKLEALNSLGCMSSMNLV 121

  Fly   366 YTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHT-------------MSK---Y 414
            .|...:..|||.:.:....||..|...||:..|...|..|.:.|.             |||   |
Zfish   122 LTKPGLLHMELLLLETFQWNLYLPTAAHFIEYYLPVAVNETDLHDGWPMTCMEKTMLYMSKYADY 186

  Fly   415 FIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRP-I 478
            |:|::..|:....:.||.::||.:..|..:|.         ....|.|.|...|.||...|.| :
Zfish   187 FLEVSLQDHAFLRFVPSLVSAACVASSRVILR---------LSPSWPPRLQRLSAYSWEQLLPCV 242

  Fly   479 TRLIAKLARDAPQA 492
            .:|:.....|..:|
Zfish   243 QKLLIAHDSDVKEA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 35/146 (24%)
Cyclin_C 389..515 CDD:281044 31/121 (26%)
ccnjXP_021336586.1 Cyclin_N2 <10..246 CDD:330468 65/262 (25%)
Cyclin_C 145..>249 CDD:308564 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.