DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccne1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001016328.1 Gene:ccne1 / 549082 XenbaseID:XB-GENE-972042 Length:408 Species:Xenopus tropicalis


Alignment Length:175 Identity:55/175 - (31%)
Similarity:87/175 - (49%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 KDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTA 340
            |:......::...|||:|:||:.||...:.|..|||.|.....||::...|:..::.|||:|:|.
 Frog   130 KNFFQKHPQLQPNMRAILLDWLMEVCEVYKLHRETFYLGQDFFDRFMATQKNVIKSRLQLIGITF 194

  Fly   341 LFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAE 405
            ||||.|.||::||.:..|.||||...|..:|..|||.|.|.:|..||....:.:...:.:.|...
 Frog   195 LFIAAKLEEIYPPKLHQFAFITDGACTEDEITSMELIIMKDLDWCLS
PMTVVSWFNVFLQVAYIR 259

  Fly   406 DEHHTMSKYF-----------IELASVDYEMATYRPSEIAAASLF 439
            :..|.:...|           ::|..:|.....|....:||::|:
 Frog   260 ELQHFLLPQFPQEVYIQIVQLLDLCVLDICCLEYPYGVLAASALY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 44/110 (40%)
Cyclin_C 389..515 CDD:281044 9/62 (15%)
ccne1NP_001016328.1 Cyclin_N 114..241 CDD:278560 44/110 (40%)
Cyclin_C <280..>340 CDD:281044 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.