DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccne2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001016267.1 Gene:ccne2 / 549021 XenbaseID:XB-GENE-923043 Length:397 Species:Xenopus tropicalis


Alignment Length:367 Identity:95/367 - (25%)
Similarity:149/367 - (40%) Gaps:89/367 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 TKKELPETKKDSLEVKKDATRMPL-IRGN-SAVTTTTSTMPTTMSLSSKRLAGIEDIDANDK--- 248
            |||...|....:.|..:||.|... |:|. |.:||.|.|....:....|.::...||....:   
 Frog    27 TKKRKSEETSTTFECHQDAKRHNYEIQGCWSEITTGTVTPCILIETPHKEMSISTDISQFSRYRF 91

  Fly   249 ENLVLVSEYV--------NDIYDYLYQVELEQPIHKDH-LAGQKEVSHKMRAVLIDWINEVHLQF 304
            :||.:....:        .|::..:...| .:.:|... |.....::..||::|:||:.||...:
 Frog    92 KNLFISRSPLPELSWGNSKDVWMKMISKE-SRYVHSSRLLQNHPTLNPDMRSILLDWLIEVSEVY 155

  Fly   305 HLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTAR 369
            .|..|||.||....||::.......::.|||:||||||||:|.||::||.:.:|.::||...:..
 Frog   156 TLHRETFYLAQDFFDRFMLTQTCVNKSMLQLIGVTALFIASKLEEIYPPKLHEFAYVTDGACSED 220

  Fly   370 QIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDE-------------------------HH 409
            .|.||||.:.||:...|.....|.:|..|.:.:..:|.                         ||
 Frog   221 DILQMELIMLKALKWELYPVTAIAWLNLYLQVSSLKDHPKLLLPQYSQEQFIHVVQLLDLCILHH 285

  Fly   410 TMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDR------HWTPTLTFYS 468
            |         |:|::   ||....||...|.|..::.    ..||.:..      ||        
 Frog   286 T---------SLDFQ---YRILAAAALYHFTSTEVVT----KATGLDMESIGECVHW-------- 326

  Fly   469 RYSAAHLRPITRLIAKLARDAPQAKLKAIYNKYQGSKFQKIA 510
                  :.|..|::   .|.:| .|||.         |:|:|
 Frog   327 ------MAPFARVV---KRSSP-FKLKV---------FKKVA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 45/127 (35%)
Cyclin_C 389..515 CDD:281044 29/153 (19%)
ccne2NP_001016267.1 Cyclin_N 111..237 CDD:365896 45/126 (36%)
Cyclin_C 240..359 CDD:367282 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.