DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccna1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001016239.1 Gene:ccna1 / 548993 XenbaseID:XB-GENE-922387 Length:426 Species:Xenopus tropicalis


Alignment Length:480 Identity:127/480 - (26%)
Similarity:206/480 - (42%) Gaps:122/480 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DALRN---AKARVDSHW------KKQPLGSTNGN-------GNGAVPPKVNEGGVSAFLRSNSVR 117
            :|.:|   ||..|.|:.      ::..||..:.|       |.|..|.|...|          :.
 Frog    22 NAFQNQCLAKVEVQSNLLPPRVSQRTVLGVISDNDQQKRSVGQGGAPAKCLPG----------IE 76

  Fly   118 NRVPTKTTVEPTK---------VTVKSSSSENVNE--------PTLKREDSNLSKKSL-TKLRAA 164
            |.:|....:.||.         .||.....|...|        |||...|||:.|::: ..|..:
 Frog    77 NVLPFAGKILPTNPALVAPKPIFTVYVDEPEEPTETYSIEEDCPTLDEVDSNIVKQNIHLLLDLS 141

  Fly   165 LAKPVMGVSGIRREPVAVSRKEAETKKELPETKKDSLEVKKDATRMPLIRGNSAVTTTTSTMPTT 229
            .|.|::..:.::..|                 :.||                             
 Frog   142 AASPMVVDTSLQASP-----------------EDDS----------------------------- 160

  Fly   230 MSLSSKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLI 294
                      |.|.||      |.||||:::|:.||.:.||:......::..|.:::..||.:|:
 Frog   161 ----------ITDPDA------VAVSEYIDEIHQYLREAELKHRPKAYYMRKQPDITSAMRTILV 209

  Fly   295 DWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFV 359
            ||:.||..::.|..||..|||..:||:|..: ...|..|||||..|:.:|:||||::||.:.:||
 Frog   210 DWLTEVGEEYKLRTETLYLAVNYLDRFLSCM-SVLRGKLQLVGTAAILLASKYEEIYPPDVDEFV 273

  Fly   360 FITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRY--SKAAGAEDEHHTMSKYFIELASVD 422
            :||||||:.:|:.:||..:.|.:..:|:.|....||.:|  .:|...:.||  ::.|..||:.:|
 Frog   274 YITDDTYSKKQLLRMEHLLLKVLAFDLTVPTISQFLLQYLQRRAVSVKTEH--LAMYLAELSLLD 336

  Fly   423 YE-MATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLA 486
            .| ...|.||..|||:..|:.:.|          |...|..||..::.|:.:.:.|....:.:.:
 Frog   337 VEPFLKYVPSITAAAAYCLANYAL----------NKVFWPETLETFTGYTLSEITPCLSDLHQAS 391

  Fly   487 RDAPQAKLKAIYNKYQGSKFQKIAL 511
            ..||....:||..||:..|:.:::|
 Frog   392 LRAPFQAQQAIREKYKTPKYMQVSL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 48/126 (38%)
Cyclin_C 389..515 CDD:281044 34/126 (27%)
ccna1NP_001016239.1 COG5024 83..415 CDD:227357 110/406 (27%)
Cyclin_N 175..301 CDD:365896 48/126 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.