DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CCNJ

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_016871843.1 Gene:CCNJ / 54619 HGNCID:23434 Length:431 Species:Homo sapiens


Alignment Length:296 Identity:73/296 - (24%)
Similarity:114/296 - (38%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 DIYDYLYQVELEQPIHKDHLAGQK-EVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQ 323
            ||:..|...||:.|.:|    ||. ::|  :|....|.|..|..:|.|......|||.::|.::.
Human    63 DIHQALRYKELKLPSYK----GQSPQLS--LRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMD 121

  Fly   324 VVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDT-------------------YTAR 369
            .. |.....|.||.::.|.:|:|:||            .:|:                   .|.:
Human   122 RY-DISIQQLHLVALSCLLLASKFEE------------KEDSVPKLEQLNSLGCMTNMNLVLTKQ 173

  Fly   370 QIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHT-------------MSK---YFIEL 418
            .:..|||.:.:....||..|...||:..|...|..|.:.|.             |:|   ||:|:
Human   174 NLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEV 238

  Fly   419 ASVDYEMATYRPSEIAAASLFLSLHLLNGN-------HRAGTGFNDRHWTPTLTFYSRYSAAHLR 476
            :..||....|.||.:|||.:..|..:|..:       ||. |.::   |...:....|...||..
Human   239 SLQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRL-TAYS---WDFLVQCIERLLIAHDN 299

  Fly   477 PITRLIAKLARDAPQ-AKLKAIYNKYQGSK---FQK 508
            .:.....:..:..|| |:|.......|.|:   ||:
Human   300 DVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 35/146 (24%)
Cyclin_C 389..515 CDD:281044 37/147 (25%)
CCNJXP_016871843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.