DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccnf

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_012825809.1 Gene:ccnf / 496496 XenbaseID:XB-GENE-963729 Length:764 Species:Xenopus tropicalis


Alignment Length:265 Identity:71/265 - (26%)
Similarity:128/265 - (48%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SEYVNDIYDYLYQVELEQPIHKDHL-AGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAII 318
            ||.||.::      :...||:|..: ..||.::..||.:||||:.||......::....:.|.::
 Frog   286 SELVNQVF------QSSLPINKTSIFTTQKGMNDTMRYILIDWLVEVATMKDFSSLCLHMTVGLV 344

  Fly   319 DRYLQVVKDTKRTYLQLVGVTALFIATKY--EELFPPAIGDFVFITDDTYTARQIRQMELQIFKA 381
            ||||: ::...|..|||||:..:.|.|::  :|:.  .|.:.|::||:||....:.:|..:|..|
 Frog   345 DRYLK-LRSVPRAKLQLVGIACMVICTRFISKEIL--TIREAVWLTDNTYKYEDLVRMMGEIISA 406

  Fly   382 IDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLLN 446
            ::..:..|..:.:....|.....:.....:..|..||:.:..|::||.|:::||.:|.|:..|  
 Frog   407 LEGKIRMPTVVDYKDVLSHLIPLDRSTLHLCSYISELSLLYTELSTYSPAQLAAGALLLARIL-- 469

  Fly   447 GNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK--LARDAP----QAKLKAIYNKYQGSK 505
              |:..     |.|...|...:.::..||.|...|:.|  ...|||    |..|.|:..::|...
 Frog   470 --HKQA-----RPWPAQLAETTGFTLEHLTPCVVLLHKKCFHDDAPKDYRQVSLTAVKQRFQDDL 527

  Fly   506 FQKIA 510
            :.:|:
 Frog   528 YDQIS 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 36/129 (28%)
Cyclin_C 389..515 CDD:281044 31/128 (24%)
ccnfXP_012825809.1 FBOX 34..74 CDD:197608
SLR repeat 87..111 CDD:276807
Cyclin_N 301..412 CDD:365896 34/113 (30%)
Cyclin_C 430..533 CDD:367282 29/112 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.