DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CycG

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster


Alignment Length:244 Identity:49/244 - (20%)
Similarity:97/244 - (39%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SSKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVE-LEQPIH----------KDHLAGQKEVS 286
            ||..|..:||      :...|.|:   ::|:.|.:.: |:...|          ::..||.::.|
  Fly   221 SSSSLKKLED------QLHALTSD---ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGS 276

  Fly   287 HKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELF 351
            ..:...|..|       :.|.::....|::::||:|..:. .|..::..:.|.:..:|.|..:|.
  Fly   277 AYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMA-VKPKHMACMSVASFHLAIKQLDLK 333

  Fly   352 PPAIGDFVFITDDTYTARQIRQME---------------------LQIFKAIDCNLSRPLPIHFL 395
            |....|.|.|:....||..:.:|.                     |:|:.|:..||::.:...|.
  Fly   334 PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFF 398

  Fly   396 RRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHL 444
            :.|.:....|:..:.     :|:...|.:.....||.:|.  :.:.|||
  Fly   399 KFYQQLIKLEELENR-----LEILMCDVKTTVITPSTLAL--VLICLHL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 30/158 (19%)
Cyclin_C 389..515 CDD:281044 11/56 (20%)
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.