DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccne2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001002075.1 Gene:ccne2 / 415165 ZFINID:ZDB-GENE-030131-9689 Length:392 Species:Danio rerio


Alignment Length:332 Identity:86/332 - (25%)
Similarity:148/332 - (44%) Gaps:42/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RKEAETKKELPE-TKKDSLEVKK-----DATRMPLIRGNSAVTTTTSTMPTTMSLSSKRLAGIED 242
            :::.|..:.:|. .||...|::.     |.:...||.     |........|.:||..:....::
Zfish    25 KRKGECNRRVPSAAKKQHYEIQNRCFEGDVSASVLIE-----TPQKEVQQETSNLSGFKRFRFKN 84

  Fly   243 IDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLA 307
            :.........|.....:|::..:...||:....|..:.....:..||||:|:||:.||...:.|.
Zfish    85 LFVKPSPLPCLSWASSDDVWIKMLNKELKYVHDKSFIQQHSALQPKMRAILLDWLMEVSEVYTLH 149

  Fly   308 AETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIR 372
            .|||.||..|.||::...||..:..|||:|:|:||||:|.||::||.:.:|.::||......:|.
Zfish   150 RETFYLAQDIFDRFMLTQKDIGKDQLQLIGITSLFIASKIEEIYPPKLQEFAYVTDGACNEEEIL 214

  Fly   373 QMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYF-----------IELASVDYEMA 426
            ..||.:.||::.:|.....|.:|:.||:....:||.:.:...|           ::|..:|....
Zfish   215 AKELVMLKALNWDLCPETVISWLKLYSQVDSLKDEANFLIPQFSQETYIQITQLLDLCILDINSL 279

  Fly   427 TYRPSEIAAASL--FLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAH-LRPITRLIAKLARD 488
            .|:...:|||:.  |.|..|:             |....||:.|..:... :.|..|.:    |:
Zfish   280 DYQYGVLAAAAFCHFTSFELV-------------HKVSGLTWDSISNCVRWMNPFMRTV----RE 327

  Fly   489 APQAKLK 495
            .|:.:||
Zfish   328 WPRPELK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 46/126 (37%)
Cyclin_C 389..515 CDD:281044 26/121 (21%)
ccne2NP_001002075.1 Cyclin_N 102..229 CDD:278560 46/126 (37%)
Cyclin_C 232..353 CDD:281044 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.