DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccna1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_997983.2 Gene:ccna1 / 404206 ZFINID:ZDB-GENE-040311-2 Length:391 Species:Danio rerio


Alignment Length:335 Identity:102/335 - (30%)
Similarity:170/335 - (50%) Gaps:45/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KKDATRMPLIRGNSAVTTTT--STMPTTMSLSSKRLA---GIEDI----------------DAND 247
            |:|.:......|:|.:.|.|  |...|:..|.|:.|.   .::||                :|..
Zfish    63 KRDVSTFRASIGDSVIETATVQSVKSTSFLLPSELLVLDDAVQDIGSGSFMDSSMHSLADEEAAS 127

  Fly   248 KENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQ 312
            .|:::.||||..||:.||.:.|::......::..|.::::.||.:|:||:.||..::.|.:||..
Zfish   128 SEDVLCVSEYAEDIHRYLRECEVKYRPKPGYMRKQPDITNCMRVILVDWLVEVGEEYKLCSETLY 192

  Fly   313 LAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQ 377
            |||..:||:|..: ...|..|||||..|:.:|.||||::||.:.:||:|||||||.:|:.:||..
Zfish   193 LAVNYLDRFLSCM-SVLRGKLQLVGTAAILLAAKYEEVYPPEVDEFVYITDDTYTKKQLLRMEQH 256

  Fly   378 IFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSK------YFIELASVDYE-MATYRPSEIAA 435
            :.:.:..:::.|....||.:||.      |.|..::      |..||:.::.: ...|.||:.||
Zfish   257 LLRVLAFDMTAPTIHQFLMQYSL------EEHVCARTLNLALYLSELSLLEVDPFVQYLPSKTAA 315

  Fly   436 ASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARDAPQAKLKAIYNK 500
            |:..|:.:.|||          ..|...|..::.||.|.:.|..:.:.||...|.....:||..|
Zfish   316 AAYCLANYTLNG----------ALWPENLYAFTGYSLAVIGPCLKELHKLHLGAGSRPQQAIQEK 370

  Fly   501 YQGSKFQKIA 510
            |:.||:..::
Zfish   371 YKSSKYHGVS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 48/126 (38%)
Cyclin_C 389..515 CDD:281044 35/129 (27%)
ccna1NP_997983.2 Cyclin_N 140..266 CDD:278560 48/126 (38%)
Cyclin_C <305..384 CDD:281044 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.