DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnjl

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:270 Identity:61/270 - (22%)
Similarity:109/270 - (40%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQ 323
            :|::..|.:.||:.|..:.|     ....|.|...:|.:..:....||......||:.::|.::.
Mouse    12 SDVHCTLREKELKLPTFRAH-----SPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMD 71

  Fly   324 VVKDTKRTYLQLVGVTALFIATKY---EELFP--PAIGDFVFITDDTY--TARQIRQMELQIFKA 381
            ....|....|..|.|:.|.:|:|:   |:..|  ..|.:...::...:  |.:::...||.:.:|
Mouse    72 QYNITTSKQLYTVAVSCLLLASKFEDREDRVPKLEQINNTRILSSQNFSLTKKELLTTELLLLEA 136

  Fly   382 IDCNLSRPLPIHFLRRYSKAAGAEDEHH-----------------TMSKYFIELASVDYEMATYR 429
            ...:|..|.|.|||..|..|:.::.:||                 ..:.||:|:...|:....::
Mouse   137 FSWDLCLPTPAHFLDYYLLASISQKDHHCHAWPTTCLRKTKECLKEYAHYFLEVTLQDHIFYKFQ 201

  Fly   430 PSEIAAASLFLS---LHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIA----KLAR 487
            ||.:|||.:..|   |.|            ..:||..|...|.||..||.....::.    .:.:
Mouse   202 PSVVAAACVGASRICLQL------------SPYWTRDLQRVSSYSLEHLSTCIEILLVAYDNVLK 254

  Fly   488 DAPQAKLKAI 497
            ||...|.:.:
Mouse   255 DAVAVKSQTL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 28/133 (21%)
Cyclin_C 389..515 CDD:281044 32/133 (24%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 23/97 (24%)
Cyclin_C 144..>246 CDD:281044 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.