DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnb2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001009470.1 Gene:Ccnb2 / 363088 RGDID:1308176 Length:398 Species:Rattus norvegicus


Alignment Length:397 Identity:147/397 - (37%)
Similarity:215/397 - (54%) Gaps:40/397 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VNEPTLKREDSNL-------SKKSLTKLRAALAKPVMGVSGIRREPVAVSRKEAETKKELPETK- 197
            :..||:..:..|:       :|..:|..||.|.:  :| :.:|..|..|::|...||..:..|| 
  Rat     4 LRRPTVSSDLKNIDTGVNPKAKSHVTVRRAVLEE--IG-NKVRARPAQVAKKPQNTKVPVQPTKA 65

  Fly   198 -KDSLEVKKDATRMPLIRGNSAVTTTTSTMPTTMSLSSKR-----------LAGIEDIDANDKEN 250
             ..|.:.|..|:..|:   ..........:|....:|.|.           |..|||||..|.||
  Rat    66 INASKQPKPTASVKPV---QMETLAPKDPLPAPEDVSMKEESLCQAFSDALLCKIEDIDNEDGEN 127

  Fly   251 LVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAV 315
            ..|.|:||.|||.||.|:|..|.|:...|.| ::::.:|||:|:||:.:||.:|.|..||..:.:
  Rat   128 PQLCSDYVKDIYQYLRQLEALQSINPHFLDG-RDINGRMRAILVDWLVQVHSKFRLLQETLYMCI 191

  Fly   316 AIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFK 380
            ||:||:|| .:...|..|||||:|||.:|:||||:|.|.|.|||:|||:.||:.|||:||..|.|
  Rat   192 AIMDRFLQ-AQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILK 255

  Fly   381 AIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLL 445
            .:...|.||||:|||||.|||...:.|.||::||.:||..|||:|..|.||::|||:..||..:|
  Rat   256 ELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQKVL 320

  Fly   446 NGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK--LARDAPQAKLKAIYNKYQGSKFQK 508
                  |.|    .|.....:|:.|..:.:..:.:.:||  :..:....|..|:.|||..|:..|
  Rat   321 ------GQG----KWNLKQQYYTGYMESEILEVMQHMAKNVVKVNENLTKFIAVKNKYASSRLLK 375

  Fly   509 IALRTEL 515
            |:...:|
  Rat   376 ISTIPQL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 61/126 (48%)
Cyclin_C 389..515 CDD:281044 46/127 (36%)
Ccnb2NP_001009470.1 Cyclin_N 137..262 CDD:278560 61/126 (48%)
Cyclin_C 264..382 CDD:281044 46/127 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.