DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccne2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001102126.1 Gene:Ccne2 / 362485 RGDID:1307783 Length:405 Species:Rattus norvegicus


Alignment Length:298 Identity:78/298 - (26%)
Similarity:131/298 - (43%) Gaps:50/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 AVSRKEAETKKELPE--TKKDSLEVKKDATRMPLIRGNSAVTTTTSTMPTTMSLSSKRLAGIEDI 243
            |..||.|:..|:..|  |||...|::.  ...|::.|..:......|....:..|          
  Rat    31 AKKRKTAQDVKKRTEEITKKHQYEIRN--CWPPVLSGGISPCIIIETPHKEIGTS---------- 83

  Fly   244 DANDKENLVLVSEYVN-------------DIYDYLYQVELEQPIHKDHLAGQKEVSH-----KMR 290
            |.:...|....:.::|             :::..:.|.| .:.:|..|.    ||.|     :||
  Rat    84 DFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKE-SRYVHDKHF----EVLHSDLEPQMR 143

  Fly   291 AVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAI 355
            ::|:||:.||...:.|..|||.||....||::...||..:..|||:|:|:||||:|.||::.|.:
  Rat   144 SILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKL 208

  Fly   356 GDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM-----SKYF 415
            .:|.::||...:...|.:|||.|.||:...|.....|.:|..:.:....:|....:     .:.|
  Rat   209 QEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDIPKVLLPQYSQETF 273

  Fly   416 IELA--------SVDYEMATYRPSEIAAASLFLSLHLL 445
            |::|        ::|.....||....||...|.|:.::
  Rat   274 IQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 47/131 (36%)
Cyclin_C 389..515 CDD:281044 13/70 (19%)
Ccne2NP_001102126.1 CYCLIN_SF 101..237 CDD:424085 47/140 (34%)
CYCLIN_SF 241..329 CDD:424085 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.