DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccne1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_571070.1 Gene:ccne1 / 30188 ZFINID:ZDB-GENE-980526-168 Length:410 Species:Danio rerio


Alignment Length:359 Identity:92/359 - (25%)
Similarity:148/359 - (41%) Gaps:90/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NRVPTKTTVEPTK----VTVK-SSSSENVNEPTLKREDSNLSKKSLTKLRAALAKPVMG-VSGIR 176
            :..|..|:|.|.|    |.:. ....|.|.|.|.|::.::          .|...|..| .|..|
Zfish    16 DEAPKTTSVRPRKRKADVAIHLQDPDEEVTEMTRKKQCAS----------QACWNPDTGYTSPCR 70

  Fly   177 REPVAVSRKEAETKKELPETKKDSLEVKKDATRMPLIRGNSA----------VTTTTSTMPTTMS 231
            |.|         |..|:.|               |:..|:..          :|.|.||....:.
Zfish    71 RIP---------TPDEVEE---------------PVAFGSVGFTQYASESIFITPTRSTPLPALC 111

  Fly   232 LSSKRLAGIEDIDAN--DKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLI 294
            .:||     :::..|  .|:.|.|....|.:.:..|      ||              ||||:|:
Zfish   112 WASK-----DEVWNNLLGKDKLYLRDTRVMERHPNL------QP--------------KMRAILL 151

  Fly   295 DWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFV 359
            ||:.||...:.|..|||.|.....||::...::..:|.|||:|::.||||.|.||::||.:..|.
Zfish   152 DWLMEVCEVYKLHRETFYLGQDYFDRFMATQENVLKTTLQLIGISCLFIAAKMEEIYPPKVHQFA 216

  Fly   360 FITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYF--------- 415
            ::||...|...|..||:.|.|.::.:||...|:.:|..|.:.|..::....::..:         
Zfish   217 YVTDGACTEDDILSMEIIIMKELNWSLSPLTPVAWLNIYMQMAYLKETAEVLTAQYPQATFVQIA 281

  Fly   416 --IELASVDYEMATYRPSEIAAASL--FLSLHLL 445
              ::|..:|.....:..|.:||::|  |.||.|:
Zfish   282 ELLDLCILDVRSLEFSYSLLAASALFHFSSLELV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 42/126 (33%)
Cyclin_C 389..515 CDD:281044 14/70 (20%)
ccne1NP_571070.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 5/14 (36%)
Cyclin_N 117..244 CDD:278560 47/146 (32%)
Cyclin_C 247..368 CDD:281044 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.