DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccna1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001011949.1 Gene:Ccna1 / 295052 RGDID:1310639 Length:421 Species:Rattus norvegicus


Alignment Length:264 Identity:88/264 - (33%)
Similarity:146/264 - (55%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 NLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLA 314
            :::.|:||..:|:.||.:.|:.......::..|.:::..|||:|:||:.||..::.|..||..||
  Rat   160 DVINVTEYAEEIHRYLREAEVRHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLA 224

  Fly   315 VAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIF 379
            |..:||:|..: ...|..|||||..|:.:|:||||::||.:.:||:|||||||.||:.:||..:.
  Rat   225 VNFLDRFLSCM-SVLRGKLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLL 288

  Fly   380 KAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYE-MATYRPSEIAAASLFLSLH 443
            |.:..:|:.|....||.:|.:..|.......::||..||:.::.: ...|.||.:|||:..|:.:
  Rat   289 KVLAFDLTVPTTNQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANY 353

  Fly   444 LLNGNHRAGTGFNDRH-WTPTLTFYSRYSAAHLRPITRLIAKLARDAPQAKLKAIYNKYQGSKFQ 507
            ::|           || |..||..::.||...:.|....:.|.....|....:||..||:.||:.
  Rat   354 IVN-----------RHFWPETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQQAIREKYKASKYL 407

  Fly   508 KIAL 511
            .::|
  Rat   408 HVSL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 50/126 (40%)
Cyclin_C 389..515 CDD:281044 34/125 (27%)
Ccna1NP_001011949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 53/134 (40%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 34/125 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.