DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccng2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001099195.1 Gene:Ccng2 / 29157 RGDID:1305002 Length:344 Species:Rattus norvegicus


Alignment Length:301 Identity:66/301 - (21%)
Similarity:117/301 - (38%) Gaps:51/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LSSKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHL------AGQKEVSHKMR 290
            |.::.|||.|.:......|.            ||.|.:..||..|...      .....:..::|
  Rat     4 LGAEHLAGGEGVQLFGLLNF------------YLEQEQRYQPREKGLTLMEATPENDNTLCSRLR 56

  Fly   291 AVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKY--EELFPP 353
            ...::.:..:...|....|||.|||.|:||:|.::| .|..:|..:||....:|.:.  ||...|
  Rat    57 NAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMK-VKPKHLSCIGVCCFLLAARLAEEECDIP 120

  Fly   354 AIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIEL 418
            ...|.:.|:....||..|::||..|.:.:...|.....::||..|......   |....|..:.|
  Rat   121 PTHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHAIVFC---HSPERKEVLSL 182

  Fly   419 ASVDYEM---------ATYRPSEIAAASL-----------FLSLHLLNGNHRAGTGFNDRHWTPT 463
            ..::.::         :..:||.:|...|           .|.:.||...|...:.....:|...
  Rat   183 DKLEAQLKACNCRLVFSKAKPSVLALCLLNLEIETIKSVELLEILLLVKKHLKISDTEFFYWREL 247

  Fly   464 LT-FYSRYSAAH-LRP-ITRLIAKLARDAPQAKLKAIYNKY 501
            :: ..:.||:.| .:| :.:|:..::|...|    :::|.|
  Rat   248 VSKCLAEYSSPHCCKPDLKKLVWIVSRRTAQ----SLHNSY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 35/134 (26%)
Cyclin_C 389..515 CDD:281044 24/136 (18%)
Ccng2NP_001099195.1 CYCLIN_CCNG2 55..150 CDD:410287 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.