DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccne1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001094291.1 Gene:Ccne1 / 25729 RGDID:2294 Length:411 Species:Rattus norvegicus


Alignment Length:408 Identity:100/408 - (24%)
Similarity:169/408 - (41%) Gaps:113/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KDAAQKDSKDLKLTDALRNAKARVDSHWKKQPLGSTNGNGNGAVPPKVNEGGVSAFLRSNSVRNR 119
            ::..::||||              .|:.|::      |..:.:|..:..:..|:.||:.      
  Rat     3 RERKERDSKD--------------HSNMKEE------GGSDLSVRSRKRKANVAVFLQD------ 41

  Fly   120 VPTKTTVEPTKVTVKSSSSENVNEPTLKREDSNLSKKSLTKLRAALAKPVMGVSGIRREPVAVSR 184
             |.:...:..| ||||..|   ::|.  .:||            |...|.        ..:....
  Rat    42 -PDEEIAKIDK-TVKSQDS---SQPW--DDDS------------ACVDPC--------SFIPTPN 79

  Fly   185 KEAETKKELPETKKDSLEVKKD-ATRMPLIR-GNSAVTTTTSTMPTTMSLSSKRLAGIEDI--DA 245
            ||.:.:.|.|:|.....:::.. |:.:|::. ||.                       |::  ..
  Rat    80 KEEDNELEYPKTAFQPRKIRPPRASPLPVLNWGNR-----------------------EEVWRIM 121

  Fly   246 NDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAET 310
            .:||...|..|:      :|.:..|.|.              :|||||:||:.||...:.|..||
  Rat   122 LNKEKTYLRDEH------FLQRHPLLQA--------------RMRAVLLDWLMEVCEVYKLHRET 166

  Fly   311 FQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQME 375
            |.||....|||:...::..:|.|||:|::|||||:|.||::||.:..|.::||...:..:|..||
  Rat   167 FYLAQDFFDRYMASQQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTME 231

  Fly   376 LQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHT-MSKY----FIELAS------VDYEMATYR 429
            |.:.||:...||....:.:|..|.:.|...|.... |.:|    |:::|.      :|.....:.
  Rat   232 LMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFP 296

  Fly   430 PSEIAAASL--FLSLHLL 445
            ...:||::|  |.||.|:
  Rat   297 YGVLAASALYHFSSLELM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 45/126 (36%)
Cyclin_C 389..515 CDD:281044 16/70 (23%)
Ccne1NP_001094291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 12/67 (18%)
CYCLIN_SF 104..240 CDD:424085 53/178 (30%)
CYCLIN_CCNE1_rpt2 244..357 CDD:410284 16/71 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.