DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnj

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_766427.1 Gene:Ccnj / 240665 MGIID:2443297 Length:379 Species:Mus musculus


Alignment Length:294 Identity:71/294 - (24%)
Similarity:112/294 - (38%) Gaps:67/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 DIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQV 324
            ||:..|...||:.|.:|    ||.. ...:|....|.|..|..:|.|......|||.::|.::..
Mouse    15 DIHQALRYKELKLPSYK----GQSP-QLNLRRYFADLIAIVSNRFTLCPPARHLAVYLLDLFMDR 74

  Fly   325 VKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDT-------------------YTARQ 370
            . |.....|.||.::.|.:|:|:||            .:|:                   .|.:.
Mouse    75 Y-DISIQQLHLVALSCLLLASKFEE------------KEDSVPKLEQLNSLGCMTNMNLVLTKQT 126

  Fly   371 IRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHT-------------MSK---YFIELA 419
            :..|||.:.:....||..|...||:..|...|..|.:.|.             |:|   ||:|::
Mouse   127 LLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMVCLEKTKLYMAKYADYFLEVS 191

  Fly   420 SVDYEMATYRPSEIAAASLFLSLHLLNGN-------HRAGTGFNDRHWTPTLTFYSRYSAAHLRP 477
            ..||....|.||.:|||.:..|..:|..:       ||. |.::   |...:....|...||...
Mouse   192 LQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRL-TAYS---WDFLVQCIERLLLAHDND 252

  Fly   478 ITRLIAKLARDAPQAKLKAIYNKYQGSK---FQK 508
            :.....:..:.|||:....::...|.|:   ||:
Mouse   253 VKEANKQRGQSAPQSTQLTVFQTAQPSRPVHFQQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 34/145 (23%)
Cyclin_C 389..515 CDD:281044 36/146 (25%)
CcnjNP_766427.1 CYCLIN_CCNJ-like_rpt1 34..140 CDD:410231 24/119 (20%)
CYCLIN_CCNJ-like_rpt2 145..245 CDD:410232 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.