DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccno

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001074531.1 Gene:Ccno / 218630 MGIID:2145534 Length:352 Species:Mus musculus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:131/329 - (39%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KSSSSENVNEPTLK-REDSNLSKKSLTKLRAALAKPVMGVSGIRREPVAVSRKEAETKKELPETK 197
            :..|.:|:..|..| |......||.|..|.|.......||..:...|.:.|              
Mouse    18 RRDSHQNLRAPVKKSRRPCLRRKKPLRPLNACSLPGDSGVCDLFESPSSSS-------------- 68

  Fly   198 KDSLEVKKDATRMPLIRGNSAVTTTTSTMPTTMSLSSKRLAGIEDIDANDKENLVLVSEYVNDIY 262
                    |....|.:   ||....:|.:.....|::.              :|....||....|
Mouse    69 --------DGADSPAV---SAARDCSSLLNPAQPLTAL--------------DLQTFREYGQSCY 108

  Fly   263 DY-LYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYL---Q 323
            |: ..|..|..|  ::.||.|.:|:.:.|..|:.|:.:||.||.|:.|:..|.|..:||:|   .
Mouse   109 DFRKAQENLFHP--RESLARQPQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTP 171

  Fly   324 VVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSR 388
            |..|.    .||:|||.|.||.|..|:.||.:...:.:....::.:|:..:|..:...:..:|..
Mouse   172 VAADC----FQLLGVTCLLIACKQVEVHPPRLKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGA 232

  Fly   389 PLPIHFLRRYSK---AAGAED-----EHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLL 445
            |....||..:::   .||..:     |..|:::...||:..||...||.||.:|...|.|:..||
Mouse   233 PTINFFLEHFTQWRMEAGQAEVTEALEAQTLARGVAELSLTDYAFTTYTPSLMAICCLALADGLL 297

  Fly   446 NGNH 449
            ...|
Mouse   298 QHQH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 39/130 (30%)
Cyclin_C 389..515 CDD:281044 21/69 (30%)
CcnoNP_001074531.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 5/21 (24%)
Cyclin_N 108..231 CDD:278560 39/128 (30%)
Cyclin_C 233..>301 CDD:281044 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.