DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and T24A6.1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001309661.1 Gene:T24A6.1 / 188821 WormBaseID:WBGene00020744 Length:91 Species:Caenorhabditis elegans


Alignment Length:103 Identity:24/103 - (23%)
Similarity:42/103 - (40%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 QLVGVTALFIATKYEELFP--PAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLR 396
            :|||:|::.| .|..|..|  |.:.|.:.             ||..:....:..:::|.|.....
 Worm     4 KLVGMTSMMI-KKIRENLPNNPTVPDILL-------------MERFLIGKFEFVVAKPTPSWLGS 54

  Fly   397 RYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIA 434
            .::|......:.....| .:||:.:|.....||||:.|
 Worm    55 CFAKRINLTKKMRNDVK-LLELSPIDAHFLRYRPSDAA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 12/54 (22%)
Cyclin_C 389..515 CDD:281044 12/46 (26%)
T24A6.1NP_001309661.1 COG5024 <2..88 CDD:227357 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.