DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccng1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_021336635.1 Gene:ccng1 / 171473 ZFINID:ZDB-GENE-020322-1 Length:313 Species:Danio rerio


Alignment Length:242 Identity:56/242 - (23%)
Similarity:103/242 - (42%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 TTTSTMPTTMSLSS---------KRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHK 276
            |.|..:|.|:.|.|         .:|.|:..|: :.::|.:.::..:.|     |||        
Zfish    20 TETGALPFTVQLKSLLDQESRYQPKLCGLRVIE-SAQDNGLRMTVKLRD-----YQV-------- 70

  Fly   277 DHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTAL 341
                  :|:....|.            |...||||..||.::||:|.|:| .:..:|..||:...
Zfish    71 ------RELLSLTRF------------FGFCAETFSFAVNLLDRFLAVMK-IQPKHLSCVGLCCF 116

  Fly   342 FIA--TKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGA 404
            :||  |..||...|...|.:.|:.:.:|...:.:||..|.:.::..:..|..:||||.:.  :..
Zfish   117 YIAVKTSEEEKNVPLASDLIRISQNRFTVHDMMRMEKIILEKLNWKVKAPTALHFLRFFH--SHI 179

  Fly   405 EDEHHTMSKYFIELASVD---------YEMATYRPSEIAAASLFLSL 442
            :::..|.||..:.:..::         :.....:||.:|.:.|.|.:
Zfish   180 QEKVDTESKKILNIERLEAQLKACHCSFTFTKLKPSLLALSLLALEI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 33/128 (26%)
Cyclin_C 389..515 CDD:281044 13/63 (21%)
ccng1XP_021336635.1 Cyclin_N 31..163 CDD:306612 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.