DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccni

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_059063.2 Gene:Ccni / 12453 MGIID:1341077 Length:377 Species:Mus musculus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:63/126 - (50%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 KEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK- 346
            :.||...|..:|.|:.::..||:|..|||.||.:::||:|..||...: ||..:.::..|:|.| 
Mouse    38 QNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPK-YLNCIAISCFFLAAKT 101

  Fly   347 --YEELFPPAIGDFVFITDDTY---TARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAA 402
              .:|..|.    ...:..|::   ::.:|.:||..|...::.:|....|:.||..:...|
Mouse   102 VEEDEKIPV----LKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLHIFHAIA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 30/109 (28%)
Cyclin_C 389..515 CDD:281044 4/14 (29%)
CcniNP_059063.2 Cyclin_N 39..142 CDD:365896 30/107 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.