DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnf

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_006523617.1 Gene:Ccnf / 12449 MGIID:102551 Length:790 Species:Mus musculus


Alignment Length:304 Identity:72/304 - (23%)
Similarity:136/304 - (44%) Gaps:31/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHL-AGQKEVSHKMRAVLIDWI 297
            :|..||...:....|    ..||.|..::      :..|.::|..: :.||.:|..||.:||||:
Mouse   276 AKACAGGSQLGLEGK----ACSESVCQLF------QASQAVNKQQIFSVQKGLSDTMRYILIDWL 330

  Fly   298 NEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKY--EELFPPAIGDFVF 360
            .||.......:....|.|..:||||: .:...|..|||:|:..:.|.|::  :|:.  .|.:.|:
Mouse   331 VEVATMKDFTSLCLHLTVECVDRYLR-RRLVPRYKLQLLGIACMVICTRFISKEIL--TIREAVW 392

  Fly   361 ITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEM 425
            :||:||....:.::..:|..|::..:..|..:.:................:..:..||..:...:
Mouse   393 LTDNTYKYEDLVRVMGEIISALEGKIRIPTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSL 457

  Fly   426 ATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK--LARD 488
            :.|.|:.:|:|:|.|: .|::|        ..:.||..|...:.:|.:.|.|....:.|  ...|
Mouse   458 SIYAPARLASAALLLA-RLMHG--------QTQPWTTHLWDLTGFSYSDLVPCVLSLHKKCFHDD 513

  Fly   489 AP----QAKLKAIYNKYQGSKFQKIALRTELTGALMDSIVGQSQ 528
            ||    |..|.|:..:::...:::|:....|:.|.:.|.:|..|
Mouse   514 APKDYRQVSLTAVKQRFEDKCYEEISREEVLSYADLCSTIGVKQ 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 35/129 (27%)
Cyclin_C 389..515 CDD:281044 25/131 (19%)
CcnfXP_006523617.1 FBOX 48..86 CDD:197608
Cyclin_N 296..419 CDD:365896 36/131 (27%)
Cyclin_C 438..544 CDD:367282 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.