DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccne2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:303 Identity:82/303 - (27%)
Similarity:133/303 - (43%) Gaps:60/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 AVSRKEAETKKELPE--TKKDSLEVKKDATRMPLIRGNSAVTTTTSTMPTTMSLSS--------- 234
            |..||.|:..|:..|  |||...|::.  ...|::.|..:......|....:..|.         
Mouse    30 AKKRKTAQDVKKRKEEITKKHQYEIRN--CWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRF 92

  Fly   235 KRL------------AGIEDIDAN--DKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEV 285
            |.|            |..:::..|  .|||     .||:|.:   :||     :|.|       :
Mouse    93 KNLFINPSPLPDLSWACSQEVWQNMLQKEN-----RYVHDKH---FQV-----LHSD-------L 137

  Fly   286 SHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEEL 350
            ..:||::|:||:.||...:.|..|||.||....||::...||..:..|||:|:|:||||:|.||:
Mouse   138 EPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEI 202

  Fly   351 FPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM---- 411
            :.|.:.:|.::||...:...|.:|||.|.||:...|.....|.:|..:.:....:|....:    
Mouse   203 YAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQY 267

  Fly   412 -SKYFIELA--------SVDYEMATYRPSEIAAASLFLSLHLL 445
             .:.||::|        ::|.....||....||...|.|:.::
Mouse   268 SQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 45/126 (36%)
Cyclin_C 389..515 CDD:281044 13/70 (19%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 4/10 (40%)
Cyclin_N 112..239 CDD:365896 51/146 (35%)
Cyclin_C 241..361 CDD:367282 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.