DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnd3

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001075104.1 Gene:Ccnd3 / 12445 MGIID:88315 Length:292 Species:Mus musculus


Alignment Length:164 Identity:51/164 - (31%)
Similarity:77/164 - (46%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            |||:...||.:|..|:.||..:.....:.|.||:..:||||..| .|::..|||:|...|.:|:|
Mouse    49 QKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCV-PTRKAQLQLLGTVCLLLASK 112

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHF----LRRYSKAAGAEDE 407
            ..|..|..|......||......|:|:.|:.:...:..:|:..:...|    |.|.|..:   |.
Mouse   113 LRETTPLTIEKLCIYTDQAVAPWQLREWEVLVLGKLKWD
LAAVIAHDFLALILHRLSLPS---DR 174

  Fly   408 HHTMSKY---FIELASVDYEMATYRPSEIAAASL 438
            ...:.|:   |:.|.:.||..|.|.||.||..|:
Mouse   175 QALVKKHAQTFLALCATDYTFAMYPPSMIATGSI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 33/104 (32%)
Cyclin_C 389..515 CDD:281044 17/57 (30%)
Ccnd3NP_001075104.1 CYCLIN_SF 2..151 CDD:424085 33/102 (32%)
CYCLIN_SF 156..260 CDD:424085 17/56 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.