DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and Ccnd1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001366177.1 Gene:Ccnd1 / 12443 MGIID:88313 Length:317 Species:Mus musculus


Alignment Length:242 Identity:64/242 - (26%)
Similarity:111/242 - (45%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            |||:...||.::..|:.||..:.....|.|.||:..:||:|. ::..|::.|||:|.|.:|:|:|
Mouse    49 QKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLS-LEPLKKSRLQLLGATCMFVASK 112

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRY-SKAAGAEDEHHT 410
            .:|..|.........||::....::.||||.:...:..||:...|..|:..: ||...|::...|
Mouse   113 MKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWN
LAAMTPHDFIEHFLSKMPEADENKQT 177

  Fly   411 MSKY---FIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRY-- 470
            :.|:   |:.|.:.|.:..:..||.:||.|:..::..||    .|:..|......|..|.||.  
Mouse   178 IRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLN----LGSPNNFLSCYRTTHFLSRVIK 238

  Fly   471 ---------------SAAHLRPITRLIAKLARDAPQAKLKAIYNKYQ 502
                           ...||||..:...:..::..:|.|::...:.|
Mouse   239 CDPVKALATGLWLNKDPLHLRPPLQDCLRACQEQIEALLESSLRQAQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 33/104 (32%)
Cyclin_C 389..515 CDD:281044 30/135 (22%)
Ccnd1NP_001366177.1 CYCLIN_CCND1_rpt1 3..151 CDD:410276 32/102 (31%)
CYCLIN_CCND1_rpt2 156..287 CDD:410279 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.