DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccno

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001373739.1 Gene:ccno / 101883490 -ID:- Length:300 Species:Danio rerio


Alignment Length:261 Identity:63/261 - (24%)
Similarity:111/261 - (42%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TTTTSTMPTTMSLSSKRLAGIEDI-DANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQK 283
            |.:.|.....:..|..|.|....: |..|.|...::.           ::..:|.:..:.|:.|.
Zfish     9 TLSDSGFEDELLCSPVRCASDSQVCDYEDSETCFIIQ-----------RLNQQQFLALNCLSRQP 62

  Fly   284 EVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYE 348
            :::.:.|:.|:.|:..|..|..|:.|:..|||.|:||:| :.........||:|||:|.||||..
Zfish    63 QITAEARSKLVSWLIAVRRQLSLSFESCCLAVNIMDRFL-ITTSVAADCFQLLGVTSLLIATKQV 126

  Fly   349 ELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFL------------------ 395
            |::.|.|...:.:..::::..|:..:|..|...::..|:.|....||                  
Zfish   127 EVYSPRITQLLSLCCNSFSREQLCNLECLILLRLNFRLAAPTLAFFLDYFTSRFTGHQTGEFISA 191

  Fly   396 ---RRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLLN----GNHRAGT 453
               ..:.:.:.||::...::....||:..||....|.||.||..:|.|:..||.    .|....|
Zfish   192 QNAHLHKEPSSAENKWRWLACKVCELSLADYTFNKYMPSVIAQCALKLAKDLLKTQSVQNSEDNT 256

  Fly   454 G 454
            |
Zfish   257 G 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 33/126 (26%)
Cyclin_C 389..515 CDD:281044 21/91 (23%)
ccnoNP_001373739.1 CYCLIN_SF 68..160 CDD:424085 30/92 (33%)
CYCLIN_SF 167..291 CDD:424085 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.