DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccni2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_003200952.1 Gene:ccni2 / 100330479 ZFINID:ZDB-GENE-081106-2 Length:310 Species:Danio rerio


Alignment Length:186 Identity:40/186 - (21%)
Similarity:84/186 - (45%) Gaps:16/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 PIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVG 337
            |:.|:......::|......:|.|:.|:::.|..:.||..|.|.:::..|..|| |:..||:.:.
Zfish    30 PVLKNGCIQGSDISPSQYHEVILWLREMNVIFQFSTETLALGVCVLNSLLATVK-TQLKYLKCMA 93

  Fly   338 VTALFIATKY--EELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYS- 399
            :|:|.:|.|.  |:....::.|.:..:...::..:|.:||..|...:...|....|:.|:..:. 
Zfish    94 ITSLILAAKINEEDEVIASVKDLLEQSRCKFSTAEILRMERVILHKLHWELYLATPMDFIHIFHG 158

  Fly   400 -KAAGAEDEHHTMSKYFIELA---------SVDYEMATYRPSEIAAASLFLSLHLL 445
             ..:|..|:  |..:..::.|         ...:::..::.|.:|.|.:.|.|..|
Zfish   159 LLMSGCVDQ--TQKRLCLQAALWSRQLQHCMACHQLWQFKGSILALAIITLELERL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 27/115 (23%)
Cyclin_C 389..515 CDD:281044 12/68 (18%)
ccni2XP_003200952.1 Cyclin_N 36..144 CDD:278560 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.