DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccnj

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001128285.1 Gene:ccnj / 100038087 XenbaseID:XB-GENE-485597 Length:385 Species:Xenopus tropicalis


Alignment Length:283 Identity:70/283 - (24%)
Similarity:109/283 - (38%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 ENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQL 313
            |.|....:...||:..|...||:.|.:|    ||.. ...:|....|.|..|..:|.|......|
 Frog     4 EGLWWKGQLAADIHQTLRYKELKLPSYK----GQSP-QLNLRRYFADLIAIVSNRFKLCPTARHL 63

  Fly   314 AVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDD------------TY 366
            ||.::|.::... |.....|.:|.::.|.:|:|:|:.     .|.|...|.            ..
 Frog    64 AVYLLDLFMDRY-DISIQQLHIVALSCLLLASKFEDK-----EDRVPKLDQLNSLGCMTNMNLVL 122

  Fly   367 TARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHT-------------MSK---YF 415
            |.:.:..|||.:.:..:.||..|.|.||:..|...|..:.:.|.             |:|   ||
 Frog   123 TKQNLLHMELLLLETFEWNLCLPTPAHFIEYYLSIAVHDTDLHDGWPMICLEKTKIYMAKYADYF 187

  Fly   416 IELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRP-IT 479
            :|::..|:....|.||.:|||.:..|..:|.         ....|...|...:.|:...|.| |.
 Frog   188 LEVSLQDHMFLNYVPSLVAAACVAASRIILR---------LSPSWPTRLHRLTVYAWDILVPCIE 243

  Fly   480 RLIAKLARDAPQAKLKAIYNKYQ 502
            ||:.....|..:|      ||::
 Frog   244 RLLIAHDNDVKEA------NKHK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 34/138 (25%)
Cyclin_C 389..515 CDD:281044 33/131 (25%)
ccnjNP_001128285.1 Cyclin_N 15..>109 CDD:365896 29/104 (28%)
Cyclin_C 145..>251 CDD:367282 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.