Sequence 1: | NP_001286744.1 | Gene: | CG13527 / 37615 | FlyBaseID: | FBgn0034776 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097728.2 | Gene: | CG34409 / 5740854 | FlyBaseID: | FBgn0085438 | Length: | 511 | Species: | Drosophila melanogaster |
Alignment Length: | 268 | Identity: | 63/268 - (23%) |
---|---|---|---|
Similarity: | 103/268 - (38%) | Gaps: | 82/268 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 VSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGS----------- 98
Fly 99 ----PH-------------RLRYTPG--KSVCSP-----------VSSLYVPKNFTMHNTFNMAL 133
Fly 134 MKLQEKMPSNDPR-IGFLHLP-KEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKT 196
Fly 197 YFRHYGDGM----MCAGNNNWTIDAEPCSGDIGSPLLSGK-VVVGIVAY-PIGCGCTNIPSVYTD 255
Fly 256 VFSGLRWI 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13527 | NP_001286744.1 | Tryp_SPc | 43..266 | CDD:238113 | 63/268 (24%) |
Tryp_SPc | 43..263 | CDD:214473 | 61/266 (23%) | ||
CG34409 | NP_001097728.2 | CLIP | 26..71 | CDD:288855 | |
Tryp_SPc | 249..501 | CDD:214473 | 61/266 (23%) | ||
Tryp_SPc | 252..501 | CDD:238113 | 61/266 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |