DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG34409

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:103/268 - (38%) Gaps:82/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGS----------- 98
            ::.|:|:.::.   :..|.|.|:|:..::||||||:   .::.......|..||           
  Fly   267 IAYRNRSSSRI---SFRCSGSLISSNHIVTAAHCVV---NLVSDLELSHVRLGSQDGATPFAIEQ 325

  Fly    99 ----PH-------------RLRYTPG--KSVCSP-----------VSSLYVPKNFTMHNTFNMAL 133
                |:             |:..|.|  ..:|.|           :..:.|...:::.:|.|.:.
  Fly   326 VIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSS 390

  Fly   134 MKLQEKMPSNDPR-IGFLHLP-KEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKT 196
            |.     |||... :.|:.|| .......|.:..|.            ..:|..:|:..|.:|  
  Fly   391 MD-----PSNSTAGVRFIRLPIVNTTSCAIAYASLS------------ENFQQPIVITPNHLC-- 436

  Fly   197 YFRHYGDGM----MCAGNNNWTIDAEPCSGDIGSPLLSGK-VVVGIVAY-PIGCGCTNIPSVYTD 255
                 ..||    :|.|::......:..||..|:   ||: .::||||: |..||.|.||.|||.
  Fly   437 -----AQGMPMNDVCRGDSGGPFMDDGTSGVFGT---SGRYTIIGIVAFGPTLCGVTTIPGVYTL 493

  Fly   256 VFSGLRWI 263
            |.|...||
  Fly   494 VSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/268 (24%)
Tryp_SPc 43..263 CDD:214473 61/266 (23%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 61/266 (23%)
Tryp_SPc 252..501 CDD:238113 61/266 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.