DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG34436

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:238 Identity:62/238 - (26%)
Similarity:92/238 - (38%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSS 116
            |||      .|.|.|:...:|||:|.||..|.:.:.:...|.:  ...|.:.|:   |....|.|
  Fly    50 PNK------TCSGALIHKYFVITSASCVFNQERAIVRLGQLSI--KQEHIVSYS---SDDYHVQS 103

  Fly   117 LYVPKNFTMHN-TFNMALMKLQEKMPSND--------PRIGFLHLPKEAPKIGIRHTVLGWG--R 170
            .|:.:.:...| ..::||::||     ||        |...:|.......::..|:....||  .
  Fly   104 AYIHRFYEKSNFEHDIALLELQ-----NDVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDE 163

  Fly   171 MYFGGPLA-----VHIYQVDVVLMDNAVCKTYFRHY-GDGMMCAGNNNWTIDAEPCSGDIGSPLL 229
            .|. .|.|     .||.||.        |:..|:.| .:..:|||..|    ...|. :.||||.
  Fly   164 KYI-LPAAKTSKIKHISQVK--------CENAFKLYPQNSHICAGYKN----KSKCV-ETGSPLF 214

  Fly   230 SGKV---------VVGIVAYPIGCGCTNIPSVYTDVFSGLRWI 263
            . |:         :.||.:|.....|     :||||...:.||
  Fly   215 K-KIRYYTKIRYTLFGIQSYGESRTC-----LYTDVTKYIDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/238 (26%)
Tryp_SPc 43..263 CDD:214473 60/236 (25%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 62/238 (26%)
Tryp_SPc 40..251 CDD:214473 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.