DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG34290

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:117/254 - (46%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YVVSIR---SRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWL----LVVAG--S 98
            ::||::   :|.........|:|||.|:|::|:::|||||. :..|.|.|.::    :...|  .
  Fly    52 FMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVW-RKNIHYIAAFIGYENIENIGQLQ 115

  Fly    99 PHRLRYTPGKSVCSPVSSLYV-PKNFTMHNTFNMALMKLQEKMPSN-DPRIGFLHLPKEAPKIGI 161
            |:.|         ..|..:|. |.||..    ::||:.::.:..|: ...:.:..||....|...
  Fly   116 PYGL---------ESVEYIYFQPSNFRN----DIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQ 167

  Fly   162 RHT--VLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHY-----GDGMMCA-GNNNWTIDAE 218
            ..:  ::|:|..:..||....:::.:|.::||..|:....|.     |...:|| |||.     :
  Fly   168 NESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIWAPQNGANTVCALGNNQ-----D 227

  Fly   219 PCSGDIGSPLL---SGK-VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDWASI 273
            .|.||.|.||:   .|| .:.|:|::.:.||...:||:||        :....|||..:
  Fly   228 SCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYT--------VTRPYYDWVQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/245 (26%)
Tryp_SPc 43..263 CDD:214473 63/242 (26%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 66/251 (26%)
Tryp_SPc 34..276 CDD:214473 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.