DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG34437

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:256 Identity:65/256 - (25%)
Similarity:94/256 - (36%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KFHGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVV 95
            |.|.|...| ..::..|.|.|.|        |.|.|::.|:|||.|.||..||:       ..|.
  Fly    31 KPHQDVFKE-TPWMAFIASPTKN--------CSGTLINKQYVITTASCVFDQSE-------STVF 79

  Fly    96 AGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTF--NMALMKLQE----KMPSNDPRIGFL---- 150
            .|....:.....:.|...|.|:|..|.:. ..||  ::||:.|.:    || |..|...:|    
  Fly    80 LGRFDNIPQNRNRYVKHSVQSVYTHKLYN-KQTFEHDIALLLLDDPVTFKM-SIQPICIWLGEIT 142

  Fly   151 ---HLPKEAPKIGIRHTVLGWG---RMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG----DGM 205
               ||....           ||   :|.|.....|.|.::       ..|:..|   |    ...
  Fly   143 NLNHLESNR-----------WGLSEKMIFQRINTVKILKI-------KKCRDSF---GITLKKSQ 186

  Fly   206 MCAGNNNWTIDAEPCSGDIGSPLLSGKV---VVGIVAYPIGCGCTNIPSVYTDVFSGLRWI 263
            :|||..|..|..|..|..:.....|||:   ::||.:|.:...|     :|..:...:.||
  Fly   187 ICAGFQNGNICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-----IYNKIAHYIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/244 (25%)
Tryp_SPc 43..263 CDD:214473 59/242 (24%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 60/246 (24%)
Tryp_SPc 39..242 CDD:304450 60/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.