DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG11843

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:98/251 - (39%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RTPNKYFGDNHYCGGGLLSNQWVITAAHCV---MGQSKIMYKARWLLVVAGSPHRLRYTPGKSVC 111
            |.|:.....:.:|||.|:|.::|:|||||:   .|:..::              ||......|:.
  Fly    87 RRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVV--------------RLGELDFDSLD 137

  Fly   112 SPVSSL-YVPKNFTMHNTF-------NMALMKLQE-------KMPSNDPRIGFLHLPKEAPKIGI 161
            ...:.. |:...:..|..:       ::.|:||.|       |.|:        .||.:..:...
  Fly   138 EDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPA--------CLPFQDERSSD 194

  Fly   162 RHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHY---------GDGMMCAGNNNWTIDA 217
            ....:|||........:..:.:|.:....|.|||......         |:..:|.|:.   :..
  Fly   195 SFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSE---MAQ 256

  Fly   218 EPCSGDIGSPLLSGK-------VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHT 266
            :.|:||.|.|||...       |||||.:..:.||...||.:||.|:..|.||..|
  Fly   257 DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIART 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/249 (24%)
Tryp_SPc 43..263 CDD:214473 58/246 (24%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 60/249 (24%)
Tryp_SPc 68..309 CDD:214473 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.