DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG11842

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:242 Identity:57/242 - (23%)
Similarity:99/242 - (40%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTM 125
            :|||.|:|::.|:|||||.......:..||     .|.   |.:........|..  :..|:||.
  Fly   102 FCGGTLISDRHVLTAAHCHYSPQGSVNIAR-----LGD---LEFDTNNDDADPED--FDVKDFTA 156

  Fly   126 HNTF-------NMALMKLQEKMPSNDPRIGFLH---LPKEAPKIGIRHTVLGWGRMYFGGPLAVH 180
            |..|       ::::::|...:..||    :.|   ||.:..::|.....:|||           
  Fly   157 HPEFSYPAIYNDISVVRLSRPVTFND----YKHPACLPFDDGRLGTSFIAIGWG----------- 206

  Fly   181 IYQVDVV--LMDNAVCKTYFRHYG--------------DG-----MMCAGNNNWTIDAEPCSGDI 224
              |:::|  ..:..:.|....:||              :|     .:|.|:|.   ..:.|:||.
  Fly   207 --QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNE---HKDTCNGDS 266

  Fly   225 GSPLLSGKV-------VVGIVAYPIGCGCTNIPSVYTDVFSGLRWIR 264
            |.|:|...:       |:||.:..:.|...::|::||.|...|.||:
  Fly   267 GGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 57/242 (24%)
Tryp_SPc 43..263 CDD:214473 55/239 (23%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 57/242 (24%)
Tryp_SPc 73..312 CDD:214473 55/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.