DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG11841

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:241 Identity:55/241 - (22%)
Similarity:92/241 - (38%) Gaps:67/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSP----VSSLYVPK 121
            :|||.|:||:.|:|||||...:...:...|.        ..|.:........|    |.:|....
  Fly   101 FCGGTLISNRLVLTAAHCFFSEHGEVNVVRL--------GELEFDTDTDDAEPEDFGVLALKAHP 157

  Fly   122 NFTMHNTFN-MALMKLQEKMPSNDPRIGFLH---LPKEAPKIGIRH---TVLGWGRMYFGGPLAV 179
            .|.....:| :.:::|..::..|    .:.|   ||.:.   |.:|   ..:|||:..|....:.
  Fly   158 GFENPQLYNDIGIVQLDREVKFN----RYKHPACLPFDD---GEQHESFIAIGWGQKKFAQKESK 215

  Fly   180 HIYQVDVVLMDNAVCKTYFRHYGD-------------------GMMCAGNNNWTIDAEPCSGDIG 225
            .:.:|.:            :.|.|                   ..:|.|:.:   :.:.|:||.|
  Fly   216 KLLKVQL------------QGYKDRCVSSVDANDELPNGYEPKSQLCIGSRD---NKDTCNGDSG 265

  Fly   226 SPLLSGKV-------VVGIVAYPIGCGCTNIPSVYTDVFSGLRWIR 264
            .|:|:...       |:||.:..|.|...:|||.||.|...|.||:
  Fly   266 GPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 55/241 (23%)
Tryp_SPc 43..263 CDD:214473 53/238 (22%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 54/239 (23%)
Tryp_SPc 72..310 CDD:214473 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.