DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG10232

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:246 Identity:62/246 - (25%)
Similarity:96/246 - (39%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVP------ 120
            |.|.|::.::|:||||||: :.|::.....|..|....|.:...|.   |....:...|      
  Fly   288 CSGSLINKRYVLTAAHCVV-KDKMVNTDLVLRRVRLGEHDITTNPD---CDFTGNCAAPFVEIGI 348

  Fly   121 KNFTMHNTF--------NMALMKLQEKMPSNDPRIGFLH--LPKEAPKIGI---RH--TVLGWG- 169
            :.|.:|..:        ::||::||..       :.:.|  ||...||..|   .|  .:.||| 
  Fly   349 EYFNVHEQYFNTSRFESDIALVRLQTP-------VRYTHEILPICVPKDPIPLHNHPLQIAGWGY 406

  Fly   170 ---RMYFGGPLAVHIYQVDVVLMDNAV------CK---TYFRHYGDGMMCAGNNNWTIDAEPCSG 222
               |.|            ..||:.|.|      |:   ::||:  :..:||....   ..:.|.|
  Fly   407 TKNREY------------SQVLLHNTVYENRYYCQDKISFFRN--ESQICASGIR---GEDSCEG 454

  Fly   223 DIGSPLL--------SGKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWIR 264
            |.|.||:        ....:.|||:| ...|| ...|.|||...:...||:
  Fly   455 DSGGPLMLTLNNDYQDIVYLAGIVSYGSENCG-DRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/246 (25%)
Tryp_SPc 43..263 CDD:214473 60/243 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 62/246 (25%)
Tryp_SPc 260..503 CDD:214473 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.