DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG16710

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:291 Identity:68/291 - (23%)
Similarity:109/291 - (37%) Gaps:84/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FHGDETLE-----LAKYVVSIRSRTP-NKYFGDNHYCGGGLLSNQWVITAAHCV----------- 79
            |.|:||..     :|..:.:.|||:. |:.....  |.|.|::|::|:|||||:           
  Fly   107 FGGEETQPNELPWMALILYAHRSRSVWNERLVSR--CAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    80 MGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSND 144
            :|:..|:          .:|..:.:..|:..|:| ..|.:..:.::.:...|..    |:.|.||
  Fly   170 LGEHNIL----------SNPDCVTHINGREHCAP-EHLEIDVDLSIKHRHYMVF----EERPYND 219

  Fly   145 PRIGFLHLPKEAPKIGIRHT-------------------------VLGWGRMYFGGPLAVHIYQV 184
              |..|.|     |..:|:|                         :.|||..:..|...| :.|.
  Fly   220 --IALLRL-----KFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNV-LLQA 276

  Fly   185 DVVLMDNAVCKTYFRHYG---DGMMCAGNNNWTIDAEPCSGDIGSPLLS----GK----VVVGIV 238
            .|...:...|.......|   :..:||||....   :.|.||.|.||::    |.    .:.||.
  Fly   277 YVNGRNADECSLSEPSLGLDKETHICAGNLGGN---DTCKGDSGGPLMAIMERGDEEFVYLAGIT 338

  Fly   239 AYPIG-CGCTNIPSVYTDVFSGLRWIRHTAY 268
            :|... ||..  |:.||.....:.||....|
  Fly   339 SYGYSQCGYG--PAAYTKTSKFVEWILWNMY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/271 (23%)
Tryp_SPc 43..263 CDD:214473 60/268 (22%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 65/284 (23%)
Tryp_SPc 106..362 CDD:238113 65/284 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.