DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG31199

DIOPT Version :10

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:214 Identity:43/214 - (20%)
Similarity:70/214 - (32%) Gaps:76/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIM---------------------------------------- 86
            |.|.|:|.:.|:..|||.:..:.:.                                        
  Fly    71 CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIA 135

  Fly    87 ----YKARWL---LVVAGSPHRLRYTPG-KSVCSPVSSLYVPKNFTM-HNTFNMALMKLQE---- 138
                |.:|.|   |.|.......:..|. ..:|.|..||.   |.|: ..||.:|.:::.|    
  Fly   136 IHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLL---NETLVAQTFVVAGLRVFEDFRL 197

  Fly   139 KMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRM----YFGGPLA-----VHI----YQVDVVL-- 188
            |...|....||.. .|....:...:||.|:.:.    |.|.||.     .|:    |.|.:::  
  Fly   198 KTWVNTLSRGFCQ-SKVKTLVTSSNTVCGYHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDW 261

  Fly   189 --MDNAVCKTY--FRHYGD 203
              .:|.:..::  .|:|.|
  Fly   262 RWENNRIMSSFLAIRNYMD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 43/214 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:473915 39/189 (21%)

Return to query results.
Submit another query.