DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG31219

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:99/243 - (40%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPG--------KSVCS-PVSS 116
            :|.|.|::|::|:|:||||.|..:.:.    |..|....|.:.|.|.        .:.|: |...
  Fly   119 FCAGSLINNRYVLTSAHCVNGIPRDLS----LKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLE 179

  Fly   117 LYVPKNFTMHNTF----------NMALMKLQEKMPSNDPRIGFLHLPKEAPKIGI----RHTVLG 167
            :.:.| ..:|..|          ::||::|  |||.. .|.|.  :|...||.|.    :..:.|
  Fly   180 IKLEK-IIVHGLFSSISNRNIEYDIALLRL--KMPVR-YRTGI--MPICIPKHGFFAKSKLEIAG 238

  Fly   168 WGRMYFGGPLAVHIYQVDVVLMDN-------AVCKTYFRHYG---DGMMCAGNNNWTIDAEPCSG 222
            ||:...|        |...|||..       |||...|.:..   ...:|||..:   ..:.|.|
  Fly   239 WGKTNEG--------QFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYD---GVDTCQG 292

  Fly   223 DIGSPLL-----SGKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWIR 264
            |.|.||:     |...:.||..| ...||...||.:||...:.|.||:
  Fly   293 DSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 67/243 (28%)
Tryp_SPc 43..263 CDD:214473 65/240 (27%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 65/240 (27%)
Tryp_SPc 90..342 CDD:238113 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.