DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG5255

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:291 Identity:63/291 - (21%)
Similarity:117/291 - (40%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILITVMVILSGAHRMKRLSSPKF------HGDETLE-LAKYVVSIRSRTPNKYFGDN-HYCGGGL 66
            :::..:|:.:.:...:.|..|::      .|:|... ||.|.:|::.      .|.. |.|||.:
  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQG------IGSGAHSCGGAI 61

  Fly    67 LSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTF-- 129
            :..:|:||||||..|:....::     |:.|:         :.:....|..|.|.....|:.:  
  Fly    62 IDERWIITAAHCTRGRQATAFR-----VLTGT---------QDLHQNGSKYYYPDRIVEHSNYAP 112

  Fly   130 -----NMALMKLQEKM---PSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDV 186
                 ::||:.|.|.:   .:..|    :.|..||...|.|..:.|||.:..||.:...:..::|
  Fly   113 RKYRNDIALLHLNESIVFDNATQP----VELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEV 173

  Fly   187 VLMDNAVCKTYFRHYGD-----GMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGC 246
            ..:....|:.  .|...     |.:|..|:.   ....|.||.|.||:....:|.:|.:.:.|. 
  Fly   174 NYVPFEQCRA--AHDNSTRVDIGHVCTFNDK---GRGACHGDSGGPLVHNGKLVALVNWGLPCA- 232

  Fly   247 TNIPSVYTDVFSGLRWIRHTAYDWASITKTN 277
                ..|.|..:.:.:.........|::||:
  Fly   233 ----KGYPDAHASISYYHDFIRTHLSLSKTD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 53/238 (22%)
Tryp_SPc 43..263 CDD:214473 53/235 (23%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 57/253 (23%)
Tryp_SPc 30..252 CDD:238113 57/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.