DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG4053

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:127/272 - (46%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LITVMVILSGAH----RMKRLSSPKF------HGDETLE-LAKYVVSIRSRTPNKYFGDNHYCGG 64
            |..:.::|.|..    |.|||.:.|.      .|.|..: :|.|.|||::      ....|.|.|
  Fly     5 LSLIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQT------IWKTHICSG 63

  Fly    65 GLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVC---SPVSSLY-VPKNFTM 125
            .:|:.||::||.||.:.     :....|.::.|:..||.  ||:::.   :.|..|| :|  :..
  Fly    64 VILNEQWILTAGHCALD-----FSIEDLRIIVGTNDRLE--PGQTLFPDEALVHCLYDIP--YVY 119

  Fly   126 HNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMD 190
            :|  ::||:.:.|.:..|| |...:.|.:|.|..|...|:.|||......|...::..:::.::.
  Fly   120 NN--DIALIHVNESIIFND-RTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIA 181

  Fly   191 NAVCKTYFRHYGDGMMCAGNNNWTIDAE-PCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYT 254
            :..|:..: .:.||:.......:|.:.| .||||.|.||:....:||:|.:...|| ..:|.:|.
  Fly   182 HEECRERW-DFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACG-VGMPDMYA 244

  Fly   255 DVFSGLRWIRHT 266
            :......|||.|
  Fly   245 NTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/227 (27%)
Tryp_SPc 43..263 CDD:214473 59/224 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 62/238 (26%)
Tryp_SPc 35..256 CDD:238113 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.