DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG17475

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:295 Identity:74/295 - (25%)
Similarity:113/295 - (38%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LITVMVIL--------SGAHRMKRLSS------PKFHG-----------DETLELAKYVVSIRSR 50
            ::.::|||        ..|.|:.:||.      .|..|           |..|..|||.:|::  
  Fly     6 VVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQ-- 68

  Fly    51 TPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVS 115
              ..|.|  |.|||.::..:.|:||||||.|     |...:|.|:.|:   :.|....:|     
  Fly    69 --GMYGG--HICGGCIIDERHVLTAAHCVYG-----YNPTYLRVITGT---VEYEKPDAV----- 116

  Fly   116 SLYVPKNFTMHNTFN-------MALMKLQEKMPSNDPRIGFLHLPKEAPKI----GIRHTVLGWG 169
              |..:...:|..:|       :||::|.:.:..|:     ...|.|.|..    |.:..:.|||
  Fly   117 --YFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNE-----YTQPAELPTAPVANGTQLLLTGWG 174

  Fly   170 RMYFGG---PLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSG 231
            .....|   .:....|...||.   :.|:....:......|......|.....|.||.|.||...
  Fly   175 STELWGDTPDILQKAYLTHVVY---STCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHN 236

  Fly   232 KVVVGIV--AYPIGCGCTNIPSVYTDVFSGLRWIR 264
            .|:.|:|  .||...|   :|..:.:|:..|.|||
  Fly   237 GVLYGLVNWGYPCALG---VPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/238 (26%)
Tryp_SPc 43..263 CDD:214473 58/235 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 62/249 (25%)
Tryp_SPc 50..269 CDD:238113 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.