DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG17477

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:100/252 - (39%) Gaps:65/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYT 105
            |.|.||:::..      .:|.|||.::|::|:|||.|||.|     |....|.|..|:   :||.
  Fly    38 APYQVSLQTLL------GSHLCGGAIISDRWIITAGHCVKG-----YPTSRLQVATGT---IRYA 88

  Fly   106 -PGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHL----------------- 152
             ||        ::|.|....:|..::         .|.....||.|||                 
  Fly    89 EPG--------AVYYPDAIYLHCNYD---------SPKYQNDIGLLHLNESITFNALTQAVELPT 136

  Fly   153 ---PKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHY-----GDGMMCAG 209
               |:.|.::    ...|||.....|.|...:.:|....:::..|::....|     |...:||.
  Fly   137 SPFPRGASEL----VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAY 197

  Fly   210 NNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHT 266
            ..   .:...|.||.|.||:....:|||:.:.:.| ...:|.::.::.....|:|.|
  Fly   198 RQ---ANIGACHGDSGGPLVHQGTLVGILNFFVPC-AQGVPDIFMNIMYYRDWMRQT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 59/248 (24%)
Tryp_SPc 43..263 CDD:214473 57/245 (23%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 60/250 (24%)
Tryp_SPc 27..246 CDD:214473 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.