DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and modSP

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:243 Identity:51/243 - (20%)
Similarity:76/243 - (31%) Gaps:87/243 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DNHY-CGGGLLSNQWVITAAHCVMGQ-SKIMYKARWLLVVAGSPHR----------------LRY 104
            |.|: |||.||:...||||||||..: :::.|......|:|...:|                :..
  Fly   394 DYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEI 458

  Fly   105 TPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHL------------PKEAP 157
            .||.            |..|.:...::||:.|.|....:       |:            .||:.
  Fly   459 APGY------------KGRTENYYQDLALLTLDEPFELS-------HVIRPICVTFASFAEKESV 504

  Fly   158 KIGIRHTVLGWG-----RMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDA 217
            ...::....||.     .:.|          |..|...|:||:...|.......|......::  
  Fly   505 TDDVQGKFAGWNIENKHELQF----------VPAVSKSNSVCRRNLRDIQADKFCIFTQGKSL-- 557

  Fly   218 EPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRH 265
             .|.||.|....|                 .:|   |:.||.....||
  Fly   558 -ACQGDSGGGFTS-----------------ELP---TNAFSTWNTARH 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 51/243 (21%)
Tryp_SPc 43..263 CDD:214473 49/239 (21%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 51/243 (21%)
Tryp_SPc 371..591 CDD:304450 51/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.