DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG3505

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:96/245 - (39%) Gaps:66/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HYCGGGLLSNQWVITAAHCV--MGQSKIMYKA----RWLLVVAGSPHRLRYTPGKSV--CSPVSS 116
            |.|||.|:|:::|:||||||  ...|.:...|    .|  ..:.:|. .:|.....|  |:|...
  Fly   135 HACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEW--DTSTNPD-CQYHEDSKVADCAPPYQ 196

  Fly   117 LYVPKNFTMHNTFN---------MALMKLQEKMPSNDPRIGFLH---LPKEAPKI----GIRHTV 165
            ....:....|..:|         :||::|......||    |:.   ||.:..:.    .:...|
  Fly   197 DIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLND----FVQPICLPNKQLRADELEDLVTEV 257

  Fly   166 LGW-----GRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGD-------GMMCAGNNNWTIDAE 218
            .||     .||..|       |   |.:.....|:   |.|..       ..:|...|     ::
  Fly   258 AGWQASSSQRMRKG-------Y---VTISSIEECQ---RKYASQQLRIQASKLCGLTN-----SQ 304

  Fly   219 PCSGDIGSPLL----SGKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWI 263
            .|.|:.|.||:    .|.::.|:|:: |:.|...:.|.|||.|.|.:.||
  Fly   305 ECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/245 (25%)
Tryp_SPc 43..263 CDD:214473 60/243 (25%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 62/245 (25%)
Tryp_SPc 111..354 CDD:214473 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.