DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG9631

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:87/237 - (36%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTP--GKSVCSPVSSLYVPKNFT 124
            |...::|.:.|||||||:.|:|     |..|.|..|. |.....|  |.|:.| |:|:..|..: 
  Fly   225 CVVSVISKRTVITAAHCIYGKS-----ASQLWVYLGR-HDRNENPENGASLVS-VTSVLTPSAY- 281

  Fly   125 MHNTFNMALMKLQEKMPSNDPRIGFLHLPKE-------------------APKIGIRHTVLGWG- 169
                         |..|..|..:|.|.|...                   .|..|....|.||| 
  Fly   282 -------------EGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPPNEGDTGAVAGWGY 333

  Fly   170 -----RMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLL 229
                 :..|...::|.:...|..|.:....:.:...   ..:||||:.   ...||.||.||.|:
  Fly   334 DRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITR---RTVCAGNSE---SHGPCFGDSGSALI 392

  Fly   230 ----SGKVVVGIVAYPIGCG--C-TNIPSVYTDVFSGLRWIR 264
                :...|.|:|:.....|  | .:...:|.||...:.|:|
  Fly   393 VLRNNRWYVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWVR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/237 (25%)
Tryp_SPc 43..263 CDD:214473 58/234 (25%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 60/237 (25%)
Tryp_SPc 198..433 CDD:214473 58/234 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.