DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG9631

DIOPT Version :10

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:87/237 - (36%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTP--GKSVCSPVSSLYVPKNFT 124
            |...::|.:.|||||||:.|:|     |..|.|..|. |.....|  |.|:.| |:|:..|..: 
  Fly   225 CVVSVISKRTVITAAHCIYGKS-----ASQLWVYLGR-HDRNENPENGASLVS-VTSVLTPSAY- 281

  Fly   125 MHNTFNMALMKLQEKMPSNDPRIGFLHLPKE-------------------APKIGIRHTVLGWG- 169
                         |..|..|..:|.|.|...                   .|..|....|.||| 
  Fly   282 -------------EGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPPNEGDTGAVAGWGY 333

  Fly   170 -----RMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLL 229
                 :..|...::|.:...|..|.:....:.:...   ..:||||:.   ...||.||.||.|:
  Fly   334 DRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITR---RTVCAGNSE---SHGPCFGDSGSALI 392

  Fly   230 ----SGKVVVGIVAYPIGCG--C-TNIPSVYTDVFSGLRWIR 264
                :...|.|:|:.....|  | .:...:|.||...:.|:|
  Fly   393 VLRNNRWYVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWVR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/237 (25%)
CG9631NP_650345.1 GD_N 26..132 CDD:464985
Tryp_SPc 198..436 CDD:238113 60/237 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.