DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG9649

DIOPT Version :10

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:117/284 - (41%) Gaps:65/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSG-AHRMKRLSSPKFHGDETLELAK--YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCV 79
            ||| ..|.|.:.:|..|....:|..:  ::.::.......|   |..|||.|:|.:.||:||||.
  Fly   242 LSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY---NFLCGGTLISARTVISAAHCF 303

  Fly    80 MGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF--TMHNTFNMALMKLQEKMPS 142
            ...|:.:...|.::.:..:...| ::.|.::  .|:.|.:.:.:  .::...::||::|     |
  Fly   304 RFGSRNLPGERTIVSLGRNSLDL-FSSGATL--GVARLLIHEQYNPNVYTDADLALLQL-----S 360

  Fly   143 NDPRIG-------------FLHLPKEAPKIGIRHTVLGWGRMYFG--GPLAVHIYQVDVVLM--- 189
            |...||             .|.||.     |.:..|.|||....|  ......:...|::..   
  Fly   361 NHVDIGDYIKPICLWNENFLLELPS-----GHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWEC 420

  Fly   190 ------DNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGK----VVVGIVAYPIGC 244
                  :||  |....|    .:||.|..   .:.|||||.|..|:..:    ::.|:|:  .|.
  Fly   421 RGNLSEENA--KFITSH----TICASNAQ---ASGPCSGDSGGGLMLQEQDIWMLRGVVS--AGQ 474

  Fly   245 GCTN-----IPSVYTDVFSGLRWI 263
            ..||     :|.:||||...:.|:
  Fly   475 RMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/256 (24%)
CG9649NP_650343.1 GD_N 29..132 CDD:464985
Tryp_SPc 257..498 CDD:238113 62/267 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.