DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG16749

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:122/284 - (42%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CQYVAILITVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSN 69
            |..|..|:|...|..||.:|.|:.:..   |.::|...:|:|:|..:      .:|.|||.::|.
  Fly     8 CLAVFALLTTAGISHGAPQMGRVVNGT---DSSVEKYPFVISMRGSS------GSHSCGGSIISK 63

  Fly    70 QWVITAAHCVMGQSKIMYKARWLLVVAG-------SPHRLR---------YTPGKSVCSPVSSLY 118
            |:|:|||||..|:     ||..|.|..|       .|:.:|         |.|..:..:.:|.|.
  Fly    64 QFVMTAAHCTDGR-----KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLL 123

  Fly   119 VPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQ 183
            |.:.|..... .:|.:||        |.:.|.....:|...|:   ::|||....||.:...:.:
  Fly   124 VEEPFEFDGV-TVAPVKL--------PELAFATPQTDAGGEGV---LIGWGLNATGGYIQSTLQE 176

  Fly   184 VDVVLMDNAVCKTYFRHYGDG----MMCAGNNNWTID---AEPCSGDIGSPLLSGKVVVGIVAYP 241
            |::.:..:..|..  ||.|..    .:|.|     :|   ...||||.|.||:.....||||::.
  Fly   177 VELKVYSDEECTE--RHGGRTDPRYHICGG-----VDEGGKGQCSGDSGGPLIYNGQQVGIVSWS 234

  Fly   242 I-GCGCTNIPSVYTDVFSGLRWIR 264
            | .|.....|.||..|...:.||:
  Fly   235 IKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 68/246 (28%)
Tryp_SPc 43..263 CDD:214473 66/243 (27%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 69/260 (27%)
Tryp_SPc 30..259 CDD:238113 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.